Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein B/S100B (N-6His)

Source: E.coli. MW :12.2kD. Recombinant Human S100 Calcium Binding Protein B is produced by our E.coli expression system and the target gene encoding Met1-Glu92 is expressed with a 6His tag at the N-terminus. S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B contains two EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B plays an important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotective effects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increases following brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into the blood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytes are the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominant S100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations in serum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before gross changes develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. In addition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancy both in bioptic tissue and in serum.

Product Specifications

Gene Name

S100B

Gene ID

6285

UniProt

P04271

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PBS,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEC

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9) (MaxLight 750) discontinued
135780-ML750 100 µL

ZNF622 (Zinc Finger Protein 622, Zinc Finger-like Protein 9, ZPR9) (MaxLight 750) discontinued

Ask
View Details
HER2 antibody (Tyr1221/Tyr1222)
70R-37157 100 ug

HER2 antibody (Tyr1221/Tyr1222)

Ask
View Details
Human PIK3CG Monoclonal Antibody
E55A11282 100 µL

Human PIK3CG Monoclonal Antibody

Ask
View Details
CCKAR Human Recombinant Protein, Synthetic Nanodisc
TP721584 10 µg

CCKAR Human Recombinant Protein, Synthetic Nanodisc

Ask
View Details
Lentiviral human SCN1A sgRNA gene knockout kit - Lentiviral human SCN1A sgRNA gene knockout kit (100)
GTR15397108 1 Vial

Lentiviral human SCN1A sgRNA gene knockout kit - Lentiviral human SCN1A sgRNA gene knockout kit (100)

Ask
View Details