Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein B/S100B (N-6His)

Source: E.coli. MW :12.2kD. Recombinant Human S100 Calcium Binding Protein B is produced by our E.coli expression system and the target gene encoding Met1-Glu92 is expressed with a 6His tag at the N-terminus. S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B contains two EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B plays an important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotective effects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increases following brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into the blood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytes are the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominant S100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations in serum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before gross changes develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. In addition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancy both in bioptic tissue and in serum.

Product Specifications

Gene Name

S100B

Gene ID

6285

UniProt

P04271

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PBS,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEC

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal STAT5b Antibody (STAT5B/2657) [FITC]
NBP3-08628F 100 µL

Mouse Monoclonal STAT5b Antibody (STAT5B/2657) [FITC]

Ask
View Details
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) (NM_003365) Human 3' UTR Clone
SC201375 10 µg

Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) (NM_003365) Human 3' UTR Clone

Ask
View Details
AGFG1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-8072R-BF594 100 µL

AGFG1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
BMPR1A Antibody
MBS8504948-01 0.1 mg

BMPR1A Antibody

Ask
View Details
BMPR1A Antibody
MBS8504948-02 0.1 mL (AF405L)

BMPR1A Antibody

Ask
View Details
BMPR1A Antibody
MBS8504948-03 0.1 mL (AF405S)

BMPR1A Antibody

Ask
View Details