Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NGAL/Lipocalin-2/LCN2 (C-Fc)

Source: Human Cells. MW :48kD. Recombinant Mouse NGAL is produced by our Mammalian expression system and the target gene encoding Gln21-Asn200 is expressed with a Fc tag at the C-terminus. Lipocalin-2, also known as Neutrophil Gelatinase-Associated Lipocalin (NGAL), is a secretory protein of the lipocalin superfamily. Lipocalin-2 contains a signal peptide that enables it to be secreted and form complexes with matrix metalloproteinase-9 (MMP-9) through disulfide bonds. Similar to other lipocalin family members, Lipocalin-2 is involved in diverse cellular processes, including the transport of small hydrophobic molecules, protection of MMP-9 from proteolytic degradation, and cell signaling. Furthermore, Lipocalin-2 can tightly bind to bacterial siderophore through a cell surface receptor, possibly serving as a potent bacteriostatic agent by sequestering iron, regulating innate immunity and protecting kidney epithelial cells from ischemia–reperfusion injury. This protein is mainly expressed in neutrophils and in lower levels in the kidney, prostate, and epithelia of the respiratory and alimentary tracts.Recent evidence also suggests its role as a biomarker for renal injury and inflammation.

Product Specifications

Gene Name

Lcn2

Gene ID

16819

UniProt

P11672

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDNVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Angiopoietin 2 (ANG2) ELISA Kit
EIA05257h 1 Kit

Human Angiopoietin 2 (ANG2) ELISA Kit

Ask
View Details
Lentiviral mouse Ptgs2 shRNA (UAS) - Lentiviral mousePtgs2 shRNA (UAS, GFP) (25)
GTR15247412 1 Vial

Lentiviral mouse Ptgs2 shRNA (UAS) - Lentiviral mousePtgs2 shRNA (UAS, GFP) (25)

Ask
View Details
Rabbit Anti-Human CD44 pAb
PA4379-01 50 μL

Rabbit Anti-Human CD44 pAb

Ask
View Details
Rabbit Anti-Human CD44 pAb
PA4379-02 100 μL

Rabbit Anti-Human CD44 pAb

Ask
View Details
PDHA1 Rabbit Monoclonal Antibody [KD Validation]
E51K3096 40 µL

PDHA1 Rabbit Monoclonal Antibody [KD Validation]

Ask
View Details
Recombinant Staphylococcus aureus Multidrug export protein mepA (mepA), partial
MBS7088140 Inquire

Recombinant Staphylococcus aureus Multidrug export protein mepA (mepA), partial

Ask
View Details