Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NGAL/Lipocalin-2/LCN2 (C-6His)

Source: Human Cells. MW :21.9kD. Recombinant Mouse NGAL is produced by our Mammalian expression system and the target gene encoding Gln21-Asn200 is expressed with a 6His tag at the C-terminus. Lipocalin-2, also known as Neutrophil Gelatinase-Associated Lipocalin (NGAL), is a secretory protein of the lipocalin superfamily. Lipocalin-2 contains a signal peptide that enables it to be secreted and form complexes with matrix metalloproteinase-9 (MMP-9) through disulfide bonds. Similar to other lipocalin family members, Lipocalin-2 is involved in diverse cellular processes, including the transport of small hydrophobic molecules, protection of MMP-9 from proteolytic degradation, and cell signaling. Furthermore, Lipocalin-2 can tightly bind to bacterial siderophore through a cell surface receptor, possibly serving as a potent bacteriostatic agent by sequestering iron, regulating innate immunity and protecting kidney epithelial cells from ischemia–reperfusion injury. This protein is mainly expressed in neutrophils and in lower levels in the kidney, prostate, and epithelia of the respiratory and alimentary tracts. Recent evidence also suggests its role as a biomarker for renal injury and inflammation.

Product Specifications

Gene Name

Lcn2

Gene ID

16819

UniProt

P11672

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDNVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 1500009L16Rik shRNA (UAS) - Lentiviral mouse 1500009L16Rik shRNA (UAS, GFP) plasmid
GTR15298045 1 Vial

Lentiviral mouse 1500009L16Rik shRNA (UAS) - Lentiviral mouse 1500009L16Rik shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) (MaxLight 405) discontinued
133692-ML405 100 µL

SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FOXP1 (Forkhead Box P1, 12CC4, FLJ23741, hFKH1B, Glutamine Rich Factor 1, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (MaxLight 550) discontinued
F9049-98B-ML550 100 µL

FOXP1 (Forkhead Box P1, 12CC4, FLJ23741, hFKH1B, Glutamine Rich Factor 1, HSPC215, MGC12942, MGC88572, MGC99551, QRF1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
NGAL (LCN2) (NM_005564) Human Tagged Lenti ORF Clone
RC207685L3 10 µg

NGAL (LCN2) (NM_005564) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
6α-Hydroxy Cortisol-d4
sc-217404 1 mg

6α-Hydroxy Cortisol-d4

Sign In for Pricing
View Details
IL23R, Fc-Fusion (IgG1), Avi-Tag HiP™ Recombinant
101321 100 µg

IL23R, Fc-Fusion (IgG1), Avi-Tag HiP™ Recombinant

Sign In for Pricing
View Details