Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Activin Receptor IB/Activin RIB/ALK-4/ACVR1B (C-Fc)

Source: Human Cells. MW :37.7kD. Recombinant Mouse Activin Receptor IB is produced by our Mammalian expression system and the target gene encoding Leu32-Glu126 is expressed with a Fc tag at the C-terminus. Activin Receptor Type-1B (ACVR1B) is a single-pass type I membrane protein that belongs to the protein kinase superfamily. ACVR1B contains one GS domain and one protein kinase domain and is expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver. ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B, ACVR2A or ACVR2B activating ACVR1B through phosphorylation of its regulatory GS domain. They go on to recruit the R-SMADs, SMAD2 and SMAD3. ACVR1B also transducers signals of nodal, GDF-1, and Vg1. Mutations in ACVR1B are associated with pituitary tumors.

Product Specifications

Gene Name

Acvr1b

Gene ID

11479

UniProt

Q61271

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVEVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-3100-5p Primers
MPM00366 150 µL / 10 µM

mmu-miR-3100-5p Primers

Sign In for Pricing
View Details
KIF21B (Kinesin Family Member 21B, FLJ16314) (PE)
247900-PE 100 µL

KIF21B (Kinesin Family Member 21B, FLJ16314) (PE)

Sign In for Pricing
View Details
F10 discontinued
315496 100 µL

F10 discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal CD5L Antibody (054) [DyLight 550]
NBP2-90357R 0.1 mL

Rabbit Monoclonal CD5L Antibody (054) [DyLight 550]

Sign In for Pricing
View Details
Fluid Thioglycollate Medium
MU009-100G 1 unit

Fluid Thioglycollate Medium

Sign In for Pricing
View Details
Coagulation Factor VIII B Polypeptide (F13B) Mouse ELISA Kit
D3083 96 Tests

Coagulation Factor VIII B Polypeptide (F13B) Mouse ELISA Kit

Sign In for Pricing
View Details