Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Activin Receptor IB/Activin RIB/ALK-4/ACVR1B (C-Fc)

Source: Human Cells. MW :37.7kD. Recombinant Mouse Activin Receptor IB is produced by our Mammalian expression system and the target gene encoding Leu32-Glu126 is expressed with a Fc tag at the C-terminus. Activin Receptor Type-1B (ACVR1B) is a single-pass type I membrane protein that belongs to the protein kinase superfamily. ACVR1B contains one GS domain and one protein kinase domain and is expressed in many tissues, most strongly in kidney, pancreas, brain, lung, and liver. ACVR1B acts as a transducer of activin or activin like ligands signals. Activin binds to either ACVR2A or ACVR2B and then forms a complex with ACVR1B, ACVR2A or ACVR2B activating ACVR1B through phosphorylation of its regulatory GS domain. They go on to recruit the R-SMADs, SMAD2 and SMAD3. ACVR1B also transducers signals of nodal, GDF-1, and Vg1. Mutations in ACVR1B are associated with pituitary tumors.

Product Specifications

Gene Name

Acvr1b

Gene ID

11479

UniProt

Q61271

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVEVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdh8 Rat shRNA Plasmid (Locus ID 84408)
TL711820 1 Kit

Cdh8 Rat shRNA Plasmid (Locus ID 84408)

Sign In for Pricing
View Details
Recombinant TACC3 Antibody
RC-5936-01 50 μL

Recombinant TACC3 Antibody

Sign In for Pricing
View Details
Recombinant TACC3 Antibody
RC-5936-02 100 µL

Recombinant TACC3 Antibody

Sign In for Pricing
View Details
Recombinant TACC3 Antibody
RC-5936-03 1 mL

Recombinant TACC3 Antibody

Sign In for Pricing
View Details
GAK protein Polyclonal Antibody, Cy5.5 Conjugated
bs-7912R-Cy5.5 100 µL

GAK protein Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
TRNAG24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV752054 1.0 µg DNA

TRNAG24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details