Recombinant Mouse HLADG/CD74 (C-6His)

Source: Human Cells. MW :19.4kD. Recombinant Mouse CD74 is produced by our Mammalian expression system and the target gene encoding Gln56-Leu215 is expressed with a 6His tag at the C-terminus. Mouse HLA class II histocompatibility antigen gamma chain (CD74), is a single-pass type II membrane protein that in humans is encoded by the CD74 gene. It contains 1 thyroglobulin type-1 domain. CD74 Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

Product Specifications

Gene Name

Cd74

Gene ID

16149

UniProt

P04441

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTLVDHHHHHH