Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PRL

Source: Human Cells. MW :23.9kD. Recombinant Human Prolactin is produced by our Mammalian expression system and the target gene encoding Leu29-Cys227 is expressed with a 6His tag at the C-terminus. Prolactin (PRL) is a secreted neuroendocrine pituitary hormone that acts primarily on the mammary gland to promote lactation, but has pleiotropic effects in both males and females. Non-glycosylated prolactin is produced by the pituitary and packaged in storage granules before secretion, while glycosylated prolactin is reported to be constitutively secreted, have lower biological potency, and be removed from the circulation more quickly. Prolactin is synthesized mainly by the anterior pituitary in all mammals, where secretion is under tonic inhibition by hypothalamic dopamine. In humans, prolactin is also produced peripherally. Prolactin expression is low during early human pregnancy, but increases in late pregnancy. The prolactin receptor (PRLR) is a transmembrane type I glycoprotein that belongs to the cytokine hematopoietic receptor family. prolactin molecule is thought to bind two receptor molecules. In addition to its lactogenic activity, peripherally produced prolactin plays roles in breast and prostate cancer development, regulation of reproductive function, and immunoregulation.

Product Specifications

Gene Name

PRL

Gene ID

5617

UniProt

P01236

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ESRP1 (N-Term) Rabbit pAb
MBS8554562-01 0.1 mL

ESRP1 (N-Term) Rabbit pAb

Ask
View Details
ESRP1 (N-Term) Rabbit pAb
MBS8554562-02 0.1 mL (AF405L)

ESRP1 (N-Term) Rabbit pAb

Ask
View Details
ESRP1 (N-Term) Rabbit pAb
MBS8554562-03 0.1 mL (AF405S)

ESRP1 (N-Term) Rabbit pAb

Ask
View Details
ESRP1 (N-Term) Rabbit pAb
MBS8554562-04 0.1 mL (AF610)

ESRP1 (N-Term) Rabbit pAb

Ask
View Details
ESRP1 (N-Term) Rabbit pAb
MBS8554562-05 0.1 mL (AF635)

ESRP1 (N-Term) Rabbit pAb

Ask
View Details
ESRP1 (N-Term) Rabbit pAb
MBS8554562-06 0.1 mL (APC)

ESRP1 (N-Term) Rabbit pAb

Ask
View Details