Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD40/TNFRSF5/CD40L Receptor (C-Fc)

Source: Human Cells. MW :46.5kD. Recombinant Mouse TNFRSF5 is produced by our Mammalian expression system and the target gene encoding Leu20-Arg193 is expressed with a Fc tag at the C-terminus. CD40 is a Type I Transmembrane Glycoprotein that belongs to the TNF Receptor Superfamily. CD40 is expressed in B cells, follicular dendritic cells, dendritic cells, activated monocytes, macrophages, endothelial cells, vascular smooth muscle cells, and several tumor cell lines. The extracellular domain of CD40 is characterized by Cysteine rich repeat regions. Interaction of CD40 with its ligand (CD40L) leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Several different TRAF proteins (adaptor proteins) have been identified to serves as mediators of the signal transduction. CD40 plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation.

Product Specifications

Gene Name

Cd40

Gene ID

21939

UniProt

P27512

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

COL18A1-AS1 CytoSection
TS411563P5 25 Slides

COL18A1-AS1 CytoSection

Sign In for Pricing
View Details
Anti-SFRP4 Antibody (4F228)
MF-0088970-01 25 µL

Anti-SFRP4 Antibody (4F228)

Sign In for Pricing
View Details
Anti-SFRP4 Antibody (4F228)
MF-0088970-02 50 µL

Anti-SFRP4 Antibody (4F228)

Sign In for Pricing
View Details
Anti-SFRP4 Antibody (4F228)
MF-0088970-03 100 µL

Anti-SFRP4 Antibody (4F228)

Sign In for Pricing
View Details
Cacng6 (NM_080694) Rat Tagged ORF Clone
RR206248 10 µg

Cacng6 (NM_080694) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mini Sample ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit
MBS2578120-01 24 Tests (Limit 1)

Mini Sample ESM1 (Endothelial Cell Specific Molecule 1) ELISA Kit

Sign In for Pricing
View Details