Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD40/TNFRSF5/CD40L Receptor (C-Fc)

Source: Human Cells. MW :46.5kD. Recombinant Mouse TNFRSF5 is produced by our Mammalian expression system and the target gene encoding Leu20-Arg193 is expressed with a Fc tag at the C-terminus. CD40 is a Type I Transmembrane Glycoprotein that belongs to the TNF Receptor Superfamily. CD40 is expressed in B cells, follicular dendritic cells, dendritic cells, activated monocytes, macrophages, endothelial cells, vascular smooth muscle cells, and several tumor cell lines. The extracellular domain of CD40 is characterized by Cysteine rich repeat regions. Interaction of CD40 with its ligand (CD40L) leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Several different TRAF proteins (adaptor proteins) have been identified to serves as mediators of the signal transduction. CD40 plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation.

Product Specifications

Gene Name

Cd40

Gene ID

21939

UniProt

P27512

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rotavirus, ICP, Late Structural Virion Antigens (Biotin) discontinued
R3000-01D-Biotin 100 µL

Rotavirus, ICP, Late Structural Virion Antigens (Biotin) discontinued

Ask
View Details
A20FMDV2
HY-P1654-01 5 mg

A20FMDV2

Ask
View Details
A20FMDV2
HY-P1654-02 10 mg

A20FMDV2

Ask
View Details
ATG4C Polyclonal Antibody
RD266460A-01 60 μL

ATG4C Polyclonal Antibody

Ask
View Details
ATG4C Polyclonal Antibody
RD266460A-02 120 μL

ATG4C Polyclonal Antibody

Ask
View Details
ATG4C Polyclonal Antibody
RD266460A-03 200 µL

ATG4C Polyclonal Antibody

Ask
View Details