Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming Growth Factor- beta Receptor Type II/TGFBR2 (C-Fc)

Source: Human Cells. MW :42.3kD. Recombinant Mouse TGF beta receptor II is produced by our Mammalian expression system and the target gene encoding Ile24-Asp159 is expressed with a Fc tag at the C-terminus. Transforming growth factor- beta (TGF- beta) is an essential regulator in the processes of development, cell proliferation, and extracellular matrix deposition. TGF- beta regulates cellular processes by binding to three high-affinity cell surface receptors: TGF- beta receptor type I (TGF- beta-RI), TGF- beta receptor type II (TGF- beta-RII), and TGF- beta beta receptor type III (TGF- beta-RIII) . TGF- beta RII is consists of a C-terminal protein kinase domain and an N-terminal ectodomain and belongs to transforming growth factor-beta (TGF- beta) receptor subfamily. TGF- beta RII has a protein kinase domain which can form a heterodimeric complex with another receptor protein and bind TGF-beta. This receptor/ligand complex phosphorylates protein will enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.

Product Specifications

Gene Name

Tgfbr2

Gene ID

21813

UniProt

Q62312

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EEF1B2 (NM_021121) Human Tagged Lenti ORF Clone
RC200733L3 10 µg

EEF1B2 (NM_021121) Human Tagged Lenti ORF Clone

Ask
View Details
Irbesartan (Avapro) 10mg
A10477-10 10 mg

Irbesartan (Avapro) 10mg

Ask
View Details
JAK3 (pY785) Blocking Peptide
CBP6035-01 1 mg

JAK3 (pY785) Blocking Peptide

Ask
View Details
JAK3 (pY785) Blocking Peptide
CBP6035-02 5 mg

JAK3 (pY785) Blocking Peptide

Ask
View Details
CLDN1 (Claudin-1, Senescence-associated Epithelial Membrane Protein, CLD1, SEMP1, UNQ481/PRO944) (MaxLight 490)
MBS6200162-01 0.1 mL

CLDN1 (Claudin-1, Senescence-associated Epithelial Membrane Protein, CLD1, SEMP1, UNQ481/PRO944) (MaxLight 490)

Ask
View Details
CLDN1 (Claudin-1, Senescence-associated Epithelial Membrane Protein, CLD1, SEMP1, UNQ481/PRO944) (MaxLight 490)
MBS6200162-02 5x 0.1 mL

CLDN1 (Claudin-1, Senescence-associated Epithelial Membrane Protein, CLD1, SEMP1, UNQ481/PRO944) (MaxLight 490)

Ask
View Details