Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Exostosin-Like 2/EXTL2 (N-6His)

Source: Human Cells. MW :33.6kD. Recombinant Mouse Exostosin-like 2 is produced by our Mammalian expression system and the target gene encoding Asn43-Met330 is expressed with a 6His tag at the N-terminus. Exostosin-like 2 (EXTL2) is a member of the exostosin (EXT) -related family which contains five members: EXT1, EXT2, EXTL1, EXTL2, and EXTL3. Studies have shown that EXT gene family members have the activities of heparan sulfate-synthesizing glycosyltransferases. EXT1 and EXT2, which have been identified as causal genes for hereditary multiple exostoses, have HS-GlcAT-II and GlcNAcT-II activities. EXTL1 has GlcNAcT-II activity and EXTL3 has GlcNAcT-I and -II activities. EXTL2 has GlcNAcT-I and N-acetylgalactosaminyltransferase activities, and transfers a GlcNAc residue to the tetrasaccharide linkage region when this region is phosphorylated by a xylose kinase 1 (FAM20B) and thereby terminate chain elongation. In mice, lack of EXTL2 causes glycosaminoglycan (GAG) overproduction and structural changes of GAGs associated with pathological processes.

Product Specifications

Gene Name

Extl2

Gene ID

58193

UniProt

Q9ES89

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHNIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PALM2 (Paralemmin 2, Paralemmin-2) (HRP)
130850-HRP 100 µL

PALM2 (Paralemmin 2, Paralemmin-2) (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal ADRM1 Antibody [DyLight 405]
NBP2-81769V 0.1 mL

Rabbit Polyclonal ADRM1 Antibody [DyLight 405]

Sign In for Pricing
View Details
Rhox4c ORF Vector (Mouse) (pORF)
39555014 1.0 µg DNA

Rhox4c ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ANKRD35 Protein Vector (Human) (pPM-C-HA)
PV062403 500 ng

ANKRD35 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal MRPS21 Antibody
NBP2-98522-100ul 100 µL

Rabbit Polyclonal MRPS21 Antibody

Sign In for Pricing
View Details
TRBP Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61820R-BF405-01 20 µL

TRBP Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details