Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Exostosin-Like 2/EXTL2 (N-6His)

Source: Human Cells. MW :33.6kD. Recombinant Mouse Exostosin-like 2 is produced by our Mammalian expression system and the target gene encoding Asn43-Met330 is expressed with a 6His tag at the N-terminus. Exostosin-like 2 (EXTL2) is a member of the exostosin (EXT) -related family which contains five members: EXT1, EXT2, EXTL1, EXTL2, and EXTL3. Studies have shown that EXT gene family members have the activities of heparan sulfate-synthesizing glycosyltransferases. EXT1 and EXT2, which have been identified as causal genes for hereditary multiple exostoses, have HS-GlcAT-II and GlcNAcT-II activities. EXTL1 has GlcNAcT-II activity and EXTL3 has GlcNAcT-I and -II activities. EXTL2 has GlcNAcT-I and N-acetylgalactosaminyltransferase activities, and transfers a GlcNAc residue to the tetrasaccharide linkage region when this region is phosphorylated by a xylose kinase 1 (FAM20B) and thereby terminate chain elongation. In mice, lack of EXTL2 causes glycosaminoglycan (GAG) overproduction and structural changes of GAGs associated with pathological processes.

Product Specifications

Gene Name

Extl2

Gene ID

58193

UniProt

Q9ES89

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHNIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MK-2894 sodium salt 5mg
A11498-5 5 mg

MK-2894 sodium salt 5mg

Ask
View Details
CD81 discontinued
167731 100 µg

CD81 discontinued

Ask
View Details
Rabbit Polyclonal CCT6B Antibody
NBP2-92177-0.02mL 0.02 mL

Rabbit Polyclonal CCT6B Antibody

Ask
View Details
Rabbit Polyclonal Gastrokine 1 Antibody [DyLight 755]
NBP2-97123IR 0.1 mL

Rabbit Polyclonal Gastrokine 1 Antibody [DyLight 755]

Ask
View Details
Recombinant Human DDR1 Protein, His, Insect-5ug
QP11610-5ug 5ug

Recombinant Human DDR1 Protein, His, Insect-5ug

Ask
View Details