Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Exostosin-Like 2/EXTL2 (N-6His)

Source: Human Cells. MW :33.6kD. Recombinant Mouse Exostosin-like 2 is produced by our Mammalian expression system and the target gene encoding Asn43-Met330 is expressed with a 6His tag at the N-terminus. Exostosin-like 2 (EXTL2) is a member of the exostosin (EXT) -related family which contains five members: EXT1, EXT2, EXTL1, EXTL2, and EXTL3. Studies have shown that EXT gene family members have the activities of heparan sulfate-synthesizing glycosyltransferases. EXT1 and EXT2, which have been identified as causal genes for hereditary multiple exostoses, have HS-GlcAT-II and GlcNAcT-II activities. EXTL1 has GlcNAcT-II activity and EXTL3 has GlcNAcT-I and -II activities. EXTL2 has GlcNAcT-I and N-acetylgalactosaminyltransferase activities, and transfers a GlcNAc residue to the tetrasaccharide linkage region when this region is phosphorylated by a xylose kinase 1 (FAM20B) and thereby terminate chain elongation. In mice, lack of EXTL2 causes glycosaminoglycan (GAG) overproduction and structural changes of GAGs associated with pathological processes.

Product Specifications

Gene Name

Extl2

Gene ID

58193

UniProt

Q9ES89

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HHHHHHNIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Olfactory Receptor 1L1 (OR1L1) ELISA Kit
MBS7259308-01 48 Well

Goat Olfactory Receptor 1L1 (OR1L1) ELISA Kit

Ask
View Details
Goat Olfactory Receptor 1L1 (OR1L1) ELISA Kit
MBS7259308-02 96 Well

Goat Olfactory Receptor 1L1 (OR1L1) ELISA Kit

Ask
View Details
Goat Olfactory Receptor 1L1 (OR1L1) ELISA Kit
MBS7259308-03 5x 96 Well

Goat Olfactory Receptor 1L1 (OR1L1) ELISA Kit

Ask
View Details
Goat Olfactory Receptor 1L1 (OR1L1) ELISA Kit
MBS7259308-04 10x 96 Well

Goat Olfactory Receptor 1L1 (OR1L1) ELISA Kit

Ask
View Details
Vmn2r88 Mouse siRNA Oligo Duplex (Locus ID 669149)
SR420764 1 Kit

Vmn2r88 Mouse siRNA Oligo Duplex (Locus ID 669149)

Ask
View Details
Prdx2, Recombinant, Mouse, aa1-198, His-Tag (Peroxiredoxin-2, AL022839, Band-8, NkefB, PRP, PrxII, Tdpx1, TDX1, Torin, TPx, TPx-B, TR, TSA)
396919-01 20 µg

Prdx2, Recombinant, Mouse, aa1-198, His-Tag (Peroxiredoxin-2, AL022839, Band-8, NkefB, PRP, PrxII, Tdpx1, TDX1, Torin, TPx, TPx-B, TR, TSA)

Ask
View Details