Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kallikrein 7/KLK7 (C-6His)

Source: Human Cells. MW :26.1kD. Recombinant Mouse Kallikrein 7 is produced by our Mammalian expression system and the target gene encoding Gln22-Arg249 is expressed with a 6His tag at the C-terminus. Kallikrein7, also named as stratum corneum chymotryptic enzyme (SCCE), is a secreted protein of the Kallikrein-related peptidase (KLK) family. This family contains fifteen homologous secreted serine endopeptidases and plays a significant role in various physiological processes, including skin desquamation, semen liquefaction, neural plasticity, and body fluid homeostasis. In skin KLK5, KLK 7 and KLK14 are able to degrade corneodesmosomes, which leads to desquamation of skin surface cells. KLK activation is believed to be mediated through highly organized proteolytic cascades, regulated through a series of feedback loops, inhibitors, auto-degradation and internal cleavages. Studies have shown that one potential physiological activator for KLK7 is KLK5. Along with KLK14, these three kallikreins form a proteolytic cascade in the stratum corneum. KLK7 is primarily expressed in the skin but is also detected at relatively high levels in esophagus, heart, liver, central nervous system, kidney, pancreas, mammary and salivary glands.

Product Specifications

Gene Name

Klk7

Gene ID

23993

UniProt

Q91VE3

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cotinine-BSA (COT-BSA) Antigen (Capture)
SMAG3298 1 mg

Cotinine-BSA (COT-BSA) Antigen (Capture)

Ask
View Details
Rabbit Anti-Human IgG Fc - Alexa Fluor 680
YLF0458-01 100 µL

Rabbit Anti-Human IgG Fc - Alexa Fluor 680

Ask
View Details
Rabbit Anti-Human IgG Fc - Alexa Fluor 680
YLF0458-02 500 µL

Rabbit Anti-Human IgG Fc - Alexa Fluor 680

Ask
View Details
Rabbit Anti-Human IgG Fc - Alexa Fluor 680
YLF0458-03 1 mL

Rabbit Anti-Human IgG Fc - Alexa Fluor 680

Ask
View Details
pLV3-U6-PLEKHA7-shRNA1-CopGFP-Puro Plasmid
PVT49089 2 µg

pLV3-U6-PLEKHA7-shRNA1-CopGFP-Puro Plasmid

Ask
View Details
Human P2RX1-Strep full length protein-synthetic nanodisc
MBS1883877-01 0.01 mg

Human P2RX1-Strep full length protein-synthetic nanodisc

Ask
View Details