Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B7-2/CD86 (C-Fc)

Source: Human Cells. MW :52.2kD. Recombinant Mouse T-lymphocyte activation antigen CD86 is produced by our Mammalian expression system and the target gene encoding Val26-Glu245 is expressed with a Fc tag at the C-terminus. The protein is the receptor that involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. The protein interacts with MARCH8, human herpesvirus 8 MIR2 protein, adenovirus subgroup B fiber proteins and acts as a receptor for these viruses.It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.It contains 1 Ig-like C2-type (immunoglobulin-like) domainand 1 Ig-like V-type (immunoglobulin-like) domain.

Product Specifications

Gene Name

Cd86

Gene ID

12524

UniProt

P42082

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Cytochrome P450 1A5 (CYP1A5) ELISA Kit
MBS2615897-01 48 Well

Porcine Cytochrome P450 1A5 (CYP1A5) ELISA Kit

Sign In for Pricing
View Details
Porcine Cytochrome P450 1A5 (CYP1A5) ELISA Kit
MBS2615897-02 96 Well

Porcine Cytochrome P450 1A5 (CYP1A5) ELISA Kit

Sign In for Pricing
View Details
Porcine Cytochrome P450 1A5 (CYP1A5) ELISA Kit
MBS2615897-03 5x 96 Well

Porcine Cytochrome P450 1A5 (CYP1A5) ELISA Kit

Sign In for Pricing
View Details
Porcine Cytochrome P450 1A5 (CYP1A5) ELISA Kit
MBS2615897-04 10x 96 Well

Porcine Cytochrome P450 1A5 (CYP1A5) ELISA Kit

Sign In for Pricing
View Details
Recombinant Sclerotinia sclerotiorum Probable endonuclease lcl3 (lcl3), partial
MBS7065283 Inquire

Recombinant Sclerotinia sclerotiorum Probable endonuclease lcl3 (lcl3), partial

Sign In for Pricing
View Details
Amylopectin, amylose free
sc-487953 25 g

Amylopectin, amylose free

Sign In for Pricing
View Details