Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NKG2D Ligand 1/NKG2DL/ULBP1 (C-6His)

Source: Human Cells. MW :23.3kD. Recombinant Human NKG2D ligand 1 is produced by our Mammalian expression system and the target gene encoding Gly26-Pro215 is expressed with a 6His tag at the C-terminus. ULBP1, also known as RAET1I and NKG2DL1, is a member of the ULBP/RAET1 gene family. ULBP1 plays an important role in immune responses, especially in cancer and infectious diseases, and is well-known to bind to NKG2D together with at least ULBP 2 and 3. These proteins are distantly related to major histocompatibility class I (MHC I) molecules, possessing the alpha 1 and alpha 2 Ig-like domains, but lacking the alpha 3 domain. Unlike MHC Class I, they have no capacity to bind peptide or interact with beta2-microglobulin. It can activate multiple signaling pathways in primary NK cells, gamma delta T cells, and CD8+ alpha beta T cells, resulting in the production of cytokines and chemokines.ULBP1 is expressed in wide range of tissues including heart, brain, lung, liver, bone marrow and some tumor cells, T-cells, B-cells, As an unconventional member of the MHC class I family, ULBP1 is able to interact with soluble CMV glycoprotein UL16 in CMV infected cells. The interaction with UL16 blocked the interaction with the NKG2D receptor, and thus might escape the immune surveillance. Furthermore, UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface. The ULBP1 regulation may have implications for development of new therapeutic strategies against cancer cells.

Product Specifications

Gene Name

ULBP1

Gene ID

80329

UniProt

Q9BZM6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Complement C3 Protein, His, E.coli-10ug
QP8695-ec-10ug 10ug

Recombinant Human Complement C3 Protein, His, E.coli-10ug

Sign In for Pricing
View Details
Mouse Monoclonal TNF-alpha Antibody (6N1E7) [Alexa Fluor 647]
NBP2-27224AF647 0.1 mL

Mouse Monoclonal TNF-alpha Antibody (6N1E7) [Alexa Fluor 647]

Sign In for Pricing
View Details
Monoclonal CD45RA (Leucocyte Marker) Antibody - Without BSA and Azide, Clone: PTPRC/818
AMM01245G 0.1mg

Monoclonal CD45RA (Leucocyte Marker) Antibody - Without BSA and Azide, Clone: PTPRC/818

Sign In for Pricing
View Details
N- (4-Iodophenyl) acetamide
457241-01 100 mg

N- (4-Iodophenyl) acetamide

Sign In for Pricing
View Details
N- (4-Iodophenyl) acetamide
457241-02 250 mg

N- (4-Iodophenyl) acetamide

Sign In for Pricing
View Details
DLX3 (Distal-less Homeobox 3, AI4, TDO) (MaxLight 550)
245397-ML550 100 µL

DLX3 (Distal-less Homeobox 3, AI4, TDO) (MaxLight 550)

Sign In for Pricing
View Details