Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epidermal Growth Factor Receptor (V30G, Del31-297) /ErbB1/HER1 (C-6His)

Source: Human Cells. MW :39.7kD. Recombinant Human EGFR is produced by our Mammalian expression system and the target gene encoding Leu25-Val30Gly&Asn298-Ser645 is expressed with a 6His tag at the C-terminus. The EGFR subfamily of receptor tyrosine kinases is composed of EGFR, ErbB2, ErbB3 and ErbB4. The EGFR shares 43% - 44% aa sequence identity with the ECD of human EGFR subfamily. All these family members are type I transmembrane glycoproteins with an extracellular ligand binding domain. The extracellular ligand binding domain is containing two cysteine-rich domains separated by a spacer region and a cytoplasmic domain containing a membrane-proximal tyrosine kinase domain. Ligand binding could induce EGFR homodimerization and heterodimerization with ErbB2, resulting in cell signaling, heterodimerization tyrosine phosphorylation and kinase activation. It can bind EGF, amphiregulin, TGF-alpha, betacellulin, epiregulin, HB-EGF, epigen, and so on. Its signaling regulates multiple biological functions including cell proliferation, differentiation, motility, and apoptosis. EGFR can also be recruited to form heterodimers with the ligand-activated ErbB3 or ErbB4. EGFR is overexpressed in different tumors. Several anti-cancer drugs use EGFR as target.

Product Specifications

Gene Name

EGFR

Gene ID

1956

UniProt

P00533

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal LIMCH1 Antibody
NBP3-04737-100ul 100 µL

Rabbit Polyclonal LIMCH1 Antibody

Ask
View Details
AMOTL2, ID (Leman Coiled-coil Protein, LCCP, Angiomotin-like Protein 2, KIAA0989) (Azide free) (HRP) discontinued
A1460-50-HRP 200 µL

AMOTL2, ID (Leman Coiled-coil Protein, LCCP, Angiomotin-like Protein 2, KIAA0989) (Azide free) (HRP) discontinued

Ask
View Details
NCKX1 antibody
70R-50688 100 ul

NCKX1 antibody

Ask
View Details
DCP1B Recombinant Protein Antigen
NBP2-55470PEP 100 µL

DCP1B Recombinant Protein Antigen

Ask
View Details
Recombinant Thermoplasma acidophilum Phenylalanine--tRNA ligase alpha subunit (pheS)
MBS1212574-01 0.02 mg (E-Coli)

Recombinant Thermoplasma acidophilum Phenylalanine--tRNA ligase alpha subunit (pheS)

Ask
View Details
Recombinant Thermoplasma acidophilum Phenylalanine--tRNA ligase alpha subunit (pheS)
MBS1212574-02 0.02 mg (Yeast)

Recombinant Thermoplasma acidophilum Phenylalanine--tRNA ligase alpha subunit (pheS)

Ask
View Details