Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-4/IL-4 (C-6His)

Source: Human Cells. MW :14.6kD. Recombinant Mouse Interleukin-4 is produced by our Mammalian expression system and the target gene encoding His21-Ser140 is expressed with a 6His tag at the C-terminus. Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. IL-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response.

Product Specifications

Gene Name

Il4

Gene ID

16189

UniProt

P07750

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYSVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A)(HTLV-1) GAG Polyclonal Antibody
MBS7152440 Inquire

Rabbit anti-Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A)(HTLV-1) GAG Polyclonal Antibody

Ask
View Details
trans-3-Furanacrylic Acid
TRC-F863680-1G 1 g

trans-3-Furanacrylic Acid

Ask
View Details
Mouse Monoclonal PDGF-B Antibody (MM0014-5F66) [DyLight 488]
NB110-60980G 0.1 mL

Mouse Monoclonal PDGF-B Antibody (MM0014-5F66) [DyLight 488]

Ask
View Details
Ascorbic Acid Impurity 28
RM-A190228-01 10 mg

Ascorbic Acid Impurity 28

Ask
View Details
Ascorbic Acid Impurity 28
RM-A190228-02 25 mg

Ascorbic Acid Impurity 28

Ask
View Details
Ascorbic Acid Impurity 28
RM-A190228-03 50 mg

Ascorbic Acid Impurity 28

Ask
View Details