Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse SLAM Family Member 5/SLAMF5/CD84 (C-6His)

Source: Human Cells. MW :23.8kD. Recombinant Mouse SLAMF5 is produced by our Mammalian expression system and the target gene encoding Lys22-Pro223 is expressed with a 6His tag at the C-terminus. CD84, also called SLAMF5, is a member of the CD2 subgroup of the immunoglobulin receptor superfamily. Members of this CD2 subgroup mediate signal transduction through the interaction of its immunoreceptor tyrosine-based switch motifs (ITSM) in the intracellular region and the SH2 domain of adaptor molecules SAP (SLAM-associated protein) and EAT-2 (EWS-activated transcript 2), and accordingly modulate both adaptive and innate immune responses. CD84 expression has been documented on several hematopoietic cell types, including monocytes, macrophages, dendritic cells, B lymphocytes, and platelets. Activation of cell surface CD84 initiates a signaling cascade involving its intra-cytoplasmic tyrosine residues that results in Bcl-2 upregulation, which in turn enhances cell survival. Either immunoneutralization or blockade of CD84 with a CD84 extracellular domain protein fragment induces cell death in vitro and in vivo.

Product Specifications

Gene Name

Cd84

Gene ID

12523

UniProt

Q18PI6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KDADPVVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAVLPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZBP1 Protein (C-His, Human)
P519288 100 µg

ZBP1 Protein (C-His, Human)

Ask
View Details
(-) -Menthol
C10368 100 mg

(-) -Menthol

Ask
View Details
RAP1B siRNA (Mouse)
MBS8238273-01 15 nmol

RAP1B siRNA (Mouse)

Ask
View Details
RAP1B siRNA (Mouse)
MBS8238273-02 30 nmol

RAP1B siRNA (Mouse)

Ask
View Details
RAP1B siRNA (Mouse)
MBS8238273-03 5x 30 nmol

RAP1B siRNA (Mouse)

Ask
View Details
Cluster of Differentiation 73 (CD73) Rat ELISA Kit
B0996 96 Tests

Cluster of Differentiation 73 (CD73) Rat ELISA Kit

Ask
View Details