Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-2R a/IL-2RA/CD25 (C-6His)

Source: Human Cells. MW :25.5kD. Recombinant Mouse Interleukin-2 receptor subunit alpha is produced by our Mammalian expression system and the target gene encoding Glu22-Lys236 is expressed with a 6His tag at the C-terminus. The interleukin 2 receptor alpha (IL2RA), also called CD25, is a type I transmembrane protein that presents on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. IL2RA is a member of cytokine receptors family that utilizes the common gamma chain subunit (gc) . IL2RA is expressed in most B-cell neoplasms, some acute nonlymphocytic leukemias, neuroblastomas, and tumor infiltrating lymphocytes. IL2RA associates with IL2RB (CD122) to form a heterodimer that can act as a high-affinity receptor for IL-2.

Product Specifications

Gene Name

Il2ra

Gene ID

16184

UniProt

P01590

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Canine Envoplakin ELISA Kit
MBS107144-01 48 Well

Canine Envoplakin ELISA Kit

Ask
View Details
Canine Envoplakin ELISA Kit
MBS107144-02 96 Well

Canine Envoplakin ELISA Kit

Ask
View Details
Canine Envoplakin ELISA Kit
MBS107144-03 5x 96 Well

Canine Envoplakin ELISA Kit

Ask
View Details
Canine Envoplakin ELISA Kit
MBS107144-04 10x 96 Well

Canine Envoplakin ELISA Kit

Ask
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ABCI11 Polyclonal Antibody
MBS9004300 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ABCI11 Polyclonal Antibody

Ask
View Details
OSBPL11 (NM_022776) Human 3' UTR Clone
SC215909 10 µg

OSBPL11 (NM_022776) Human 3' UTR Clone

Ask
View Details