Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IL-2R a/IL-2RA/CD25 (C-6His)

Source: Human Cells. MW :25.5kD. Recombinant Mouse Interleukin-2 receptor subunit alpha is produced by our Mammalian expression system and the target gene encoding Glu22-Lys236 is expressed with a 6His tag at the C-terminus. The interleukin 2 receptor alpha (IL2RA), also called CD25, is a type I transmembrane protein that presents on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. IL2RA is a member of cytokine receptors family that utilizes the common gamma chain subunit (gc) . IL2RA is expressed in most B-cell neoplasms, some acute nonlymphocytic leukemias, neuroblastomas, and tumor infiltrating lymphocytes. IL2RA associates with IL2RB (CD122) to form a heterodimer that can act as a high-affinity receptor for IL-2.

Product Specifications

Gene Name

Il2ra

Gene ID

16184

UniProt

P01590

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GANAB Antibody
orb2681945-01 50 µL

GANAB Antibody

Sign In for Pricing
View Details
GANAB Antibody
orb2681945-02 100 µL

GANAB Antibody

Sign In for Pricing
View Details
GANAB Antibody
orb2681945-03 200 µL

GANAB Antibody

Sign In for Pricing
View Details
NSUN5P2 (NM_032158) Human Over-expression Lysate
LY410311 100 µg

NSUN5P2 (NM_032158) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CDH13 Protein Lysate 20ug
IHUCDH13PLLY20UG 20 µg

Human CDH13 Protein Lysate 20ug

Sign In for Pricing
View Details
PLS1, CT (PLS1, Plastin-1, Intestine-specific plastin) (PE)
MBS6335091-01 0.2 mL

PLS1, CT (PLS1, Plastin-1, Intestine-specific plastin) (PE)

Sign In for Pricing
View Details