Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuroblastoma Suppressor of Tumorigenicity 1/NBL1 (C-6His)

Source: Human Cells. MW :18.4kD. Recombinant Mouse NBL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asp178 is expressed with a 6His tag at the C-terminus. Differential screening-selected gene aberrative in neuroblastoma (DAN) is a member of the DAN family of secreted glycoproteins. DAN family antagonists are characterized by a DAN domain that contains a cystine knot motif which is essential for binding to BMP ligands. Members of this family include DAN, gremlin, protein related to DAN and cerberus (PRDC), cerberus, sclerostin (SOST) and uterine sensitization-associated gene 1 protein, and control diverse processes in growth, development and the cell cycle. It has also been reported that DAN family plays crucial role in early mouse embryo development by inhibiting the action of bone morphogenic proteins and modulating the action of transforming growth factor- beta superfamily members. DAN is synthesized by small-to intermediate-sized DRG neurons and transported to the sensory nerve terminals in the skin or to the sensory nerve terminals in the dorsal horn. It has been reported that DAN is ubiquitously expressed in adult rat and human tissues. Morphological studies have revealed that, in adult rat, DAN mRNA is expressed ubiquitously in lung and brain, but not in liver.

Product Specifications

Gene Name

Nbl1

Gene ID

17965

UniProt

Q61477

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPEEPPGAPQVEEEGAEDVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

NALCN Protein Vector (Mouse) (pPM-C-His)
PV204049 500 ng

NALCN Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Glutathione Peroxidase 1 (GPX1, GPx-1, Cellular Glutathione Peroxidase, HGNC:4553, GSHPX1, GSHPx-1 MGC14399, MGC88245) (Not for Export EU)
G8127-11B 100 µL

Glutathione Peroxidase 1 (GPX1, GPx-1, Cellular Glutathione Peroxidase, HGNC:4553, GSHPX1, GSHPx-1 MGC14399, MGC88245) (Not for Export EU)

Sign In for Pricing
View Details
Biotinylated Anti-CD20 (rituximab biosimilar) mAb
12-9085B-50 50 µg

Biotinylated Anti-CD20 (rituximab biosimilar) mAb

Sign In for Pricing
View Details
SEC22B (SEC22 Vesicle-trafficking Protein Homolog B, Vesicle-trafficking Protein SEC22b, ER-Golgi SNARE of 24kD, ERS-24, ERS24, SEC22 Vesicle-trafficking Protein-like 1, SEC22L1) (Biotin)
133081-Biotin 100 µL

SEC22B (SEC22 Vesicle-trafficking Protein Homolog B, Vesicle-trafficking Protein SEC22b, ER-Golgi SNARE of 24kD, ERS-24, ERS24, SEC22 Vesicle-trafficking Protein-like 1, SEC22L1) (Biotin)

Sign In for Pricing
View Details
MyoGEF Polyclonal Antibody, Cy7 Conjugated
bs-7756R-Cy7 100 µL

MyoGEF Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Myelin Oligodendrocyte Glycoprotein (Biotin)
548795 200 µL

Myelin Oligodendrocyte Glycoprotein (Biotin)

Sign In for Pricing
View Details