Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD5/Leu-1 (C-6His)

Source: Human Cells. MW :38.9kD. Recombinant Mouse CD5 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn370 is expressed with a 6His tag at the C-terminus. CD5 is a transmembrane glycoprotein of the conserved scavenger receptor cysteine-rich (SRCR) superfamily and expressed on thymocytes, peripheral T cells and a subset of B cells (B1-a) . Moreover, CD5 also was found expressed in small lymphocytic lymphoma, hairy cell leukaemia and mantle cell lymphoma cells. The long cytoplasmic tail of CD5 has no intrinsic enzymatic activity, but contains four tyrosine phosphorylation sites, including an immunoreceptor tyrosine-based (ITAM) -like motif (pseudo-ITAM) and an immunoreceptor tyrosine-based inhibitory (ITIM) -like motif (pseudo-ITIM), as well as multiple potential serine and threonine phosphorylation sites. It physically associates with the T cell antigen receptor (TCR) and B cell antigen receptor (BCR), where it negatively modulates the activation and differentiation signals transduced by these receptors. CD5 also plays an important role in protection from activation-induced cell death and in the recognition of pathogen associated molecular patterns (PAMPS) present on fungal surfaces.

Product Specifications

Gene Name

Cd5

Gene ID

12507

UniProt

P13379

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MS4A12 Antibody (OTI5F5) [Alexa Fluor 350]
NBP2-72791AF350 0.1 mL

Mouse Monoclonal MS4A12 Antibody (OTI5F5) [Alexa Fluor 350]

Sign In for Pricing
View Details
SMTNL1 (G-7)
sc-390369 200 µg/mL

SMTNL1 (G-7)

Sign In for Pricing
View Details
ARC Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV676537 1.0 µg DNA

ARC Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Terrein
T083-1MG 1 mg

Terrein

Sign In for Pricing
View Details
Phencyclidine (PCP)-BSA Antigen (HM298)
VAng-Cr3728-1mg 1 mg

Phencyclidine (PCP)-BSA Antigen (HM298)

Sign In for Pricing
View Details
p53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, LFS1, TP53, Transformation Related Protein 53 (TRP53), Tumor Protein p53, Tumor Suppressor p53) (AP)
MBS6123580-01 0.1 mL

p53 (Antigen NY-CO-13, BCC7, Cellular Tumor Antigen p53, LFS1, TP53, Transformation Related Protein 53 (TRP53), Tumor Protein p53, Tumor Suppressor p53) (AP)

Sign In for Pricing
View Details