Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD5/Leu-1 (C-6His)

Source: Human Cells. MW :38.9kD. Recombinant Mouse CD5 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn370 is expressed with a 6His tag at the C-terminus. CD5 is a transmembrane glycoprotein of the conserved scavenger receptor cysteine-rich (SRCR) superfamily and expressed on thymocytes, peripheral T cells and a subset of B cells (B1-a) . Moreover, CD5 also was found expressed in small lymphocytic lymphoma, hairy cell leukaemia and mantle cell lymphoma cells. The long cytoplasmic tail of CD5 has no intrinsic enzymatic activity, but contains four tyrosine phosphorylation sites, including an immunoreceptor tyrosine-based (ITAM) -like motif (pseudo-ITAM) and an immunoreceptor tyrosine-based inhibitory (ITIM) -like motif (pseudo-ITIM), as well as multiple potential serine and threonine phosphorylation sites. It physically associates with the T cell antigen receptor (TCR) and B cell antigen receptor (BCR), where it negatively modulates the activation and differentiation signals transduced by these receptors. CD5 also plays an important role in protection from activation-induced cell death and in the recognition of pathogen associated molecular patterns (PAMPS) present on fungal surfaces.

Product Specifications

Gene Name

Cd5

Gene ID

12507

UniProt

P13379

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Phospho-p53 (pT18) Antibody (23#)
RHC10001 100 μg

Anti-Phospho-p53 (pT18) Antibody (23#)

Ask
View Details
MRPL45 CytoSection
TS418954P5 25 Slides

MRPL45 CytoSection

Ask
View Details
Crizotinib
MBS6029761-01 10 mg

Crizotinib

Ask
View Details
Crizotinib
MBS6029761-02 5x 10 mg

Crizotinib

Ask
View Details