Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RANK/TNFRSF11A/CD265 (C-6His)

Source: Human Cells. MW :21.1kD. Recombinant Human Receptor Activator of NF-kappa-B is produced by our Mammalian expression system and the target gene encoding Ile30-Pro212 is expressed with a 6His tag at the C-terminus. Receptor Activator of Nuclear Factor kappa B (RANK), also known as CD265, TRANCE Receptor or TNFRSF11A, is member of the tumor necrosis factor receptor (TNFR) molecular superfamily. RANK is the receptor for RANK-Ligand (RANKL) and part of the RANK/RANKL/OPG signaling pathway that regulates osteoclast differentiation and activation. It plays a vital role in bone remodeling and repair, immune cell function, lymph node development, thermal regulation, and mammary gland development. RANK is constitutively expressed in skeletal muscle, thymus, liver, colon, small intestine, adrenal gland, osteoclast, mammary gland epithelial cells, prostate, vascular cell, and pancreas.

Product Specifications

Gene Name

TNFRSF11A

Gene ID

8792

UniProt

Q9Y6Q6

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RPL22 antibody
FNab07421 100 µg

RPL22 antibody

Ask
View Details
BAHCC1 siRNA (Mouse)
CRN3992-01 15 nmol

BAHCC1 siRNA (Mouse)

Ask
View Details
BAHCC1 siRNA (Mouse)
CRN3992-02 30 nmol

BAHCC1 siRNA (Mouse)

Ask
View Details
General Homovanillic Acid (HVA) ELISA Kit
MBS4500003-01 48 Tests

General Homovanillic Acid (HVA) ELISA Kit

Ask
View Details
General Homovanillic Acid (HVA) ELISA Kit
MBS4500003-02 96 Tests

General Homovanillic Acid (HVA) ELISA Kit

Ask
View Details
General Homovanillic Acid (HVA) ELISA Kit
MBS4500003-03 5x 96 Tests

General Homovanillic Acid (HVA) ELISA Kit

Ask
View Details