Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RANK L/TRANCE/TNFSF11 (N-6His)

Source: E.coli. MW :22.4kD. Recombinant Human Receptor Activator of NF-kappa-B ligand is produced by our E.coli expression system and the target gene encoding Ile140-Asp317 is expressed with a 6His tag at the N-terminus. CD254, also known as RANKL, TNFSF11, TRANCE, OPGL and ODF, is a type II membrane protein of the tumor necrosis factor (TNF) superfamily, and affects the immune system and control bone regeneration and remodeling. RANKL is the ligand of nuclear factor (NF) -kB (RANK) . When RANKL binds to RANK, it will undergo trimerization and then bind to an adaptor molecule TNF receptor-associated factor 6 (TRAF6) . This results in the activation of several downstream signaling cascades, including the NFkB, mitogen-activated protein kinases (MAPK), activating protein 1 (AP-1), and nuclear factor of activated T cells (NFATc1), resulting in the formation of multinucleated bone-resorbing osteoclasts. RANKL is widely expressed in skeletal muscle, thymus, liver, colon, small intestine, adrenal gland, osteoblast, mammary gland epithelial cells, prostate and pancreas.

Product Specifications

Gene Name

TNFSF11

Gene ID

8600

UniProt

O14788

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD2AP Mouse Monoclonal Antibody
AMM83502-01 1 Each

CD2AP Mouse Monoclonal Antibody

Ask
View Details
CD2AP Mouse Monoclonal Antibody
AMM83502-02 50 µL

CD2AP Mouse Monoclonal Antibody

Ask
View Details
CD2AP Mouse Monoclonal Antibody
AMM83502-03 100 µL

CD2AP Mouse Monoclonal Antibody

Ask
View Details
Goat F (ab') 2 Anti-Human IgA-BIOT
2052-08 0.5 mg

Goat F (ab') 2 Anti-Human IgA-BIOT

Ask
View Details
IQCF6 Antibody (N-term) [APR04616G]
APR04616G-01 50 µL

IQCF6 Antibody (N-term) [APR04616G]

Ask
View Details
IQCF6 Antibody (N-term) [APR04616G]
APR04616G-02 100 µL

IQCF6 Antibody (N-term) [APR04616G]

Ask
View Details