Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B7-H3/CD276 (C-6His)

Source: Human Cells. MW :47.3kD. Recombinant Human B7 Homolog 3 is produced by our Mammalian expression system and the target gene encoding Leu29-Thr461 is expressed with a 6His tag at the C-terminus. CD276, also known as B7-H3, is a member of the B7 superfamily with signature IgV and IgG regions in extracellular domains. It is a type I transmembrane protein and shares 20–27% amino acid identity with other B7 family members. B7-H3 is involved in the activation of T lymphocytes, and regulates murine bone formation. It is also reported that B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is expressed on T-cells, natural killer cells, and antigen presenting cells, as well as some non-immune cells, such as osteoblasts, fibroblasts, fibroblast-like synoviocytes and epithelial cells. High expression of B7-H3 in tumor vasculature also correlates with poor survival in patients, suggesting that it may play a role in tumor cell migration.

Product Specifications

Gene Name

CD276

Gene ID

80381

UniProt

Q5ZPR3

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human GCG
P0779-01 50 µg

Recombinant Human GCG

Ask
View Details
Recombinant Human GCG
P0779-02 200 µg

Recombinant Human GCG

Ask
View Details
Recombinant Human GCG
P0779-03 1 mg

Recombinant Human GCG

Ask
View Details
Goat anti-Mouse Whole Serum Antibody
MBS3907134-01 2 mL

Goat anti-Mouse Whole Serum Antibody

Ask
View Details
Goat anti-Mouse Whole Serum Antibody
MBS3907134-02 5x 2 mL

Goat anti-Mouse Whole Serum Antibody

Ask
View Details
SLA2 (E-8) Alexa Fluor® 647
sc-398134 AF647 200 µg/mL

SLA2 (E-8) Alexa Fluor® 647

Ask
View Details