Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B7-H3/CD276 (C-6His)

Source: Human Cells. MW :47.3kD. Recombinant Human B7 Homolog 3 is produced by our Mammalian expression system and the target gene encoding Leu29-Thr461 is expressed with a 6His tag at the C-terminus. CD276, also known as B7-H3, is a member of the B7 superfamily with signature IgV and IgG regions in extracellular domains. It is a type I transmembrane protein and shares 20–27% amino acid identity with other B7 family members. B7-H3 is involved in the activation of T lymphocytes, and regulates murine bone formation. It is also reported that B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is expressed on T-cells, natural killer cells, and antigen presenting cells, as well as some non-immune cells, such as osteoblasts, fibroblasts, fibroblast-like synoviocytes and epithelial cells. High expression of B7-H3 in tumor vasculature also correlates with poor survival in patients, suggesting that it may play a role in tumor cell migration.

Product Specifications

Gene Name

CD276

Gene ID

80381

UniProt

Q5ZPR3

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ELOVL2, NT (ELOVL2, SSC2, Elongation of very long chain fatty acids protein 2, 3-keto acyl-CoA synthase ELOVL2, ELOVL fatty acid elongase 2) (MaxLight 490) discontinued
035048-ML490 100 µL

ELOVL2, NT (ELOVL2, SSC2, Elongation of very long chain fatty acids protein 2, 3-keto acyl-CoA synthase ELOVL2, ELOVL fatty acid elongase 2) (MaxLight 490) discontinued

Ask
View Details
Human MDC (Macrophage Derived Chemokine) ELISA Kit
EH0223 96 Tests

Human MDC (Macrophage Derived Chemokine) ELISA Kit

Ask
View Details
4.1G Polyclonal Antibody
ABP50550-01 30 µL

4.1G Polyclonal Antibody

Ask
View Details
4.1G Polyclonal Antibody
ABP50550-02 100 µL

4.1G Polyclonal Antibody

Ask
View Details
4.1G Polyclonal Antibody
ABP50550-03 200 µL

4.1G Polyclonal Antibody

Ask
View Details