Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B7-1/CD80 (C-6His)

Source: Human Cells. MW :24.7kD. Recombinant Human Activation B7-1 antigen is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus. Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. It is the ligand for two different proteins on the T cell surface: CD28 and CTLA-4. Studies have shown that CTLA-4 binds mostly to CD80. The structure presents two extracellular domains: a membrane distal variable-like domain (IgV) and a membrane proximal Ig constant-like domain (IgC) along with an intracellular domain. Both IgV and IgC consist of anti-parallel beta sandwiches joined by a short linker region. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.

Product Specifications

Gene Name

CD80

Gene ID

941

UniProt

P33681

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DPY19L3 Human shRNA Plasmid Kit (Locus ID 147991)
TR304912 1 Kit

DPY19L3 Human shRNA Plasmid Kit (Locus ID 147991)

Ask
View Details
WNT10B discontinued
396160 200 µL

WNT10B discontinued

Ask
View Details
Rabbit Polyclonal Aconitase 1 Antibody
NBP1-87677 0.1 mL

Rabbit Polyclonal Aconitase 1 Antibody

Ask
View Details
Human N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
EKU10174 96 Tests

Human N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Ask
View Details