Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B7-1/CD80 (C-6His)

Source: Human Cells. MW :24.7kD. Recombinant Human Activation B7-1 antigen is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus. Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. It is the ligand for two different proteins on the T cell surface: CD28 and CTLA-4. Studies have shown that CTLA-4 binds mostly to CD80. The structure presents two extracellular domains: a membrane distal variable-like domain (IgV) and a membrane proximal Ig constant-like domain (IgC) along with an intracellular domain. Both IgV and IgC consist of anti-parallel beta sandwiches joined by a short linker region. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.

Product Specifications

Gene Name

CD80

Gene ID

941

UniProt

P33681

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLH1 (3F17) Rabbit Monoclonal Antibody
E28M1727 100 µL

MLH1 (3F17) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HDAC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C3]
TA502142AM 100 µL

HDAC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C3]

Sign In for Pricing
View Details
EHD2 (EH Domain Containing 2, PAST2) (MaxLight 490)
MBS6415348-01 0.1 mL

EHD2 (EH Domain Containing 2, PAST2) (MaxLight 490)

Sign In for Pricing
View Details
EHD2 (EH Domain Containing 2, PAST2) (MaxLight 490)
MBS6415348-02 5x 0.1 mL

EHD2 (EH Domain Containing 2, PAST2) (MaxLight 490)

Sign In for Pricing
View Details
APC Anti-Human CD20 (BCA/B20)
APC-30007-01 50 Tests

APC Anti-Human CD20 (BCA/B20)

Sign In for Pricing
View Details
APC Anti-Human CD20 (BCA/B20)
APC-30007-02 100 Tests

APC Anti-Human CD20 (BCA/B20)

Sign In for Pricing
View Details