Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B7-1/CD80 (C-6His)

Source: Human Cells. MW :24.7kD. Recombinant Human Activation B7-1 antigen is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus. Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. It is the ligand for two different proteins on the T cell surface: CD28 and CTLA-4. Studies have shown that CTLA-4 binds mostly to CD80. The structure presents two extracellular domains: a membrane distal variable-like domain (IgV) and a membrane proximal Ig constant-like domain (IgC) along with an intracellular domain. Both IgV and IgC consist of anti-parallel beta sandwiches joined by a short linker region. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.

Product Specifications

Gene Name

CD80

Gene ID

941

UniProt

P33681

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DNAH2, NT (DNAH2, DNAHC2, DNHD3, KIAA1503, Dynein heavy chain 2, axonemal, Axonemal beta dynein heavy chain 2, Ciliary dynein heavy chain 2, Dynein heavy chain domain-containing protein 3) (Azide free) (HRP) discontinued
034691-HRP 200 µL

DNAH2, NT (DNAH2, DNAHC2, DNHD3, KIAA1503, Dynein heavy chain 2, axonemal, Axonemal beta dynein heavy chain 2, Ciliary dynein heavy chain 2, Dynein heavy chain domain-containing protein 3) (Azide free) (HRP) discontinued

Ask
View Details
Recombinant Escherichia coli O6 UPF0283 membrane protein YcjF (ycjF), partial
MBS7062752 Inquire

Recombinant Escherichia coli O6 UPF0283 membrane protein YcjF (ycjF), partial

Ask
View Details
Chicken Clara Cell Protein 16 (CC16) ELISA Kit
MBS266501-01 48 Well

Chicken Clara Cell Protein 16 (CC16) ELISA Kit

Ask
View Details
Chicken Clara Cell Protein 16 (CC16) ELISA Kit
MBS266501-02 96 Well

Chicken Clara Cell Protein 16 (CC16) ELISA Kit

Ask
View Details
Chicken Clara Cell Protein 16 (CC16) ELISA Kit
MBS266501-03 5x 96 Well

Chicken Clara Cell Protein 16 (CC16) ELISA Kit

Ask
View Details
Chicken Clara Cell Protein 16 (CC16) ELISA Kit
MBS266501-04 10x 96 Well

Chicken Clara Cell Protein 16 (CC16) ELISA Kit

Ask
View Details