Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OX40/TNFRSF4/CD134 (C-6His)

Source: Human Cells. MW :21kD. Recombinant Human OX40 is produced by our Mammalian expression system and the target gene encoding Leu29-Ala216 is expressed with a 6His tag at the C-terminus. OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

Product Specifications

Gene Name

TNFRSF4

Gene ID

7293

UniProt

P43489

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal SLC9A7 Antibody [Biotin]
NBP2-98612B 0.1 mL

Rabbit Polyclonal SLC9A7 Antibody [Biotin]

Ask
View Details
SMS (Spermine Synthase, SPMSY, Spermidine Aminopropyltransferase) (MaxLight 750) discontinued
133585-ML750 100 µL

SMS (Spermine Synthase, SPMSY, Spermidine Aminopropyltransferase) (MaxLight 750) discontinued

Ask
View Details
Human Glucosamine-6-Phosphate Deaminase 2 (GNPDA2) ELISA Kit
YP-W13584-01 48 Tests

Human Glucosamine-6-Phosphate Deaminase 2 (GNPDA2) ELISA Kit

Ask
View Details
Human Glucosamine-6-Phosphate Deaminase 2 (GNPDA2) ELISA Kit
YP-W13584-02 96 Tests

Human Glucosamine-6-Phosphate Deaminase 2 (GNPDA2) ELISA Kit

Ask
View Details
Human Oxidoreductase HTATIP2, HTATIP2 ELISA KIT
ELI-38659h 96 Tests

Human Oxidoreductase HTATIP2, HTATIP2 ELISA KIT

Ask
View Details
LRAT Polyclonal Antibody
MBS9244192-01 0.1 mL

LRAT Polyclonal Antibody

Ask
View Details