Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human OX40/TNFRSF4/CD134 (C-6His)

Source: Human Cells. MW :21kD. Recombinant Human OX40 is produced by our Mammalian expression system and the target gene encoding Leu29-Ala216 is expressed with a 6His tag at the C-terminus. OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

Product Specifications

Gene Name

TNFRSF4

Gene ID

7293

UniProt

P43489

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MHC Class II (I-A k,b,d,q,r) Rat Monoclonal Antibody [Clone ID: ER-TR3]
BM4094B 200 µg

MHC Class II (I-A k,b,d,q,r) Rat Monoclonal Antibody [Clone ID: ER-TR3]

Ask
View Details
Spirapril Hydrochloride
021021 10 mg

Spirapril Hydrochloride

Ask
View Details
FEM1A
315829-01 50 µL

FEM1A

Ask
View Details
FEM1A
315829-02 100 µL

FEM1A

Ask
View Details
Mouse Cyp2j5 (NM_010007) AAV Particle
MR208031A1V 250 µL

Mouse Cyp2j5 (NM_010007) AAV Particle

Ask
View Details