Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 (C-6His)

Source: Human Cells. MW :19.9kD. Recombinant Mouse T cell Immunoglobulin and Mucin Domain-3 is produced by our Mammalian expression system and the target gene encoding Arg20-Ala193 is expressed with a 6His tag at the C-terminus. T cell immunoglobulin and mucin domain-3 (TIM3), also called hepatitis A virus cellular receptor 2 (HAVCR2), is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response. TIM3 is expressed on the Th1 cells, CD8 T-cells, monocytes, and dendritic cells, but not on Th2 cells. TIM3 expressed by monocytes and dendritic cells facilitates phagocytosis of apoptotic cells and up-regulates cross-presentation of apoptotic cell-associated antigens through interaction with phosphatidylserine. Engagement of TIM3 by its ligand galectin-9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. Stimulation of TIM3 with an agonistic antibody promotes inflammation through the activation of innate immune cells. TIM3 is also regarded as a potential target molecule for immunotherapy. TIM3 and programmed cell death 1 (PD-1) as two important coinhibitory regulators of T cell responses, have been implicated with the T-cell dysfunction or exhaustion associated with chronic HBV infection including HBV-related HCC.

Product Specifications

Gene Name

Havcr2

Gene ID

171285

UniProt

Q8VIM0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRTAHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep CP (Ceruloplasmin) ValidElisa Kit
EK343780 96 Well

Sheep CP (Ceruloplasmin) ValidElisa Kit

Ask
View Details
EVI2B (NM_006495) Human Tagged ORF Clone
RG203253 10 µg

EVI2B (NM_006495) Human Tagged ORF Clone

Ask
View Details
Anti-[KD Validated] DNMT1 (Rabbit, Monoclonal)
A106489 100 µL

Anti-[KD Validated] DNMT1 (Rabbit, Monoclonal)

Ask
View Details
alpha-Chlorophenylacetyl Chloride
TRC-C376505-250MG 250 mg

alpha-Chlorophenylacetyl Chloride

Ask
View Details
Human Secretagogin (SCGN) ELISA Kit
KTE60738-01 48 Tests

Human Secretagogin (SCGN) ELISA Kit

Ask
View Details
Human Secretagogin (SCGN) ELISA Kit
KTE60738-02 96 Tests

Human Secretagogin (SCGN) ELISA Kit

Ask
View Details