Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse TIGIT/VSIG9/VSTM3 (C-6His)

Source: Human Cells. MW :13.3kD. Recombinant Mouse TIGIT is produced by our Mammalian expression system and the target gene encoding Gly26-Phe135 is expressed with a 6His tag at the C-terminus. T cell immunoreceptor with Ig and ITIM domains (TIGIT), also called WUCAM, VSIG9 and Vstm3, is a member of the CD28 family within the Ig superfamily of proteins. TIGIT contains an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM), and is expressed on regulatory, memory, activated T cells and NK cells. TIGIT binds to CD155 (PVR) that appear on dendritic cells (DC), macrophages and endothelium with high affinity, and CD112 (PVRL2) with lower affinity, but not CD113 (PVRL3) . TIGIT-Fc fusion protein could interact with PVR on DC and enhance the secretion of IL-10, but inhibit the macrophage activation. Mice lacking TIGIT show increased T cell responses and susceptibility to autoimmune challenges, while knockdown of TIGIT with siRNA in human memory T cells did not affect T cell responses.

Product Specifications

Gene Name

Tigit

UniProt

P86176

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFGGGGSHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Protein FAM3C (FAM3C) Antibody (Biotin)
abx310394-01 20 µg

Protein FAM3C (FAM3C) Antibody (Biotin)

Ask
View Details
Protein FAM3C (FAM3C) Antibody (Biotin)
abx310394-02 50 µg

Protein FAM3C (FAM3C) Antibody (Biotin)

Ask
View Details
Protein FAM3C (FAM3C) Antibody (Biotin)
abx310394-03 100 µg

Protein FAM3C (FAM3C) Antibody (Biotin)

Ask
View Details
Protein FAM3C (FAM3C) Antibody (Biotin)
abx310394-04 200 µg

Protein FAM3C (FAM3C) Antibody (Biotin)

Ask
View Details
Protein FAM3C (FAM3C) Antibody (Biotin)
abx310394-05 1 mg

Protein FAM3C (FAM3C) Antibody (Biotin)

Ask
View Details
KIR5.1 (KCNJ16) Human qPCR Template Standard (NM_018658)
HK210708 1 Kit

KIR5.1 (KCNJ16) Human qPCR Template Standard (NM_018658)

Ask
View Details