Recombinant Mouse TIGIT/VSIG9/VSTM3 (C-6His)
Source: Human Cells. MW :13.3kD. Recombinant Mouse TIGIT is produced by our Mammalian expression system and the target gene encoding Gly26-Phe135 is expressed with a 6His tag at the C-terminus. T cell immunoreceptor with Ig and ITIM domains (TIGIT), also called WUCAM, VSIG9 and Vstm3, is a member of the CD28 family within the Ig superfamily of proteins. TIGIT contains an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM), and is expressed on regulatory, memory, activated T cells and NK cells. TIGIT binds to CD155 (PVR) that appear on dendritic cells (DC), macrophages and endothelium with high affinity, and CD112 (PVRL2) with lower affinity, but not CD113 (PVRL3) . TIGIT-Fc fusion protein could interact with PVR on DC and enhance the secretion of IL-10, but inhibit the macrophage activation. Mice lacking TIGIT show increased T cell responses and susceptibility to autoimmune challenges, while knockdown of TIGIT with siRNA in human memory T cells did not affect T cell responses.
Product Specifications
Gene Name
Tigit
UniProt
P86176
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFGGGGSHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items