Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse OX40/TNFRSF4/CD134 (N-Fc)

Source: Human Cells. MW :47.4kD. Recombinant Mouse OX40 is produced by our Mammalian expression system and the target gene encoding Val20-Pro211 is expressed with a Fc tag at the N-terminus. OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

Product Specifications

Gene Name

Tnfrsf4

Gene ID

22163

UniProt

P47741

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKDDDDKVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HOMER3 Human Recombinant Protein
TP725166 50 µg

HOMER3 Human Recombinant Protein

Ask
View Details
STK40 ORF Vector (Human) (pORF)
45754011 1.0 µg DNA

STK40 ORF Vector (Human) (pORF)

Ask
View Details
CXorf51A (NM_001144064) Human Over-expression Lysate
LY428491 100 µg

CXorf51A (NM_001144064) Human Over-expression Lysate

Ask
View Details
Recombinant IAV H1N1 (A/WSN/1933) Hemagglutinin [His]
DAG-H10700 100 µg

Recombinant IAV H1N1 (A/WSN/1933) Hemagglutinin [His]

Ask
View Details
SLC26A8 Protein (N-GST, Human)
P508421 100 µg

SLC26A8 Protein (N-GST, Human)

Ask
View Details
Opioid Receptor, kappa (KOR-1, KOR) (PE)
301436-PE 100 µL

Opioid Receptor, kappa (KOR-1, KOR) (PE)

Ask
View Details