Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse OX40/TNFRSF4/CD134 (C-Fc)

Source: Human Cells. MW :48.1kD. Recombinant Mouse OX40 is produced by our Mammalian expression system and the target gene encoding Val20-Pro211 is expressed with a Fc tag at the C-terminus. OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

Product Specifications

Gene Name

Tnfrsf4

Gene ID

22163

UniProt

P47741

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPDIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM4 Lentiviral Activation Particles (h2)
sc-402451-LAC-2 200 µL

MCM4 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
TAAR7E Adenovirus (Rat)
46032056 1.0 mL

TAAR7E Adenovirus (Rat)

Sign In for Pricing
View Details
Human GAL4 (Galectin 4) ValidElisa Kit
EK340541 96 Well

Human GAL4 (Galectin 4) ValidElisa Kit

Sign In for Pricing
View Details
Mouse Monoclonal EIF4EBP3 Antibody (OTI3B9) [CoraFluor 1]
NBP2-71383CL1 0.1 mL

Mouse Monoclonal EIF4EBP3 Antibody (OTI3B9) [CoraFluor 1]

Sign In for Pricing
View Details
Recombinant Amphidinium carterae Photosystem Q (B) protein (psbA)
MBS7027126-01 0.02 mg

Recombinant Amphidinium carterae Photosystem Q (B) protein (psbA)

Sign In for Pricing
View Details
Recombinant Amphidinium carterae Photosystem Q (B) protein (psbA)
MBS7027126-02 0.1 mg

Recombinant Amphidinium carterae Photosystem Q (B) protein (psbA)

Sign In for Pricing
View Details