Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse OX40/TNFRSF4/CD134 (C-Fc)

Source: Human Cells. MW :48.1kD. Recombinant Mouse OX40 is produced by our Mammalian expression system and the target gene encoding Val20-Pro211 is expressed with a Fc tag at the C-terminus. OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

Product Specifications

Gene Name

Tnfrsf4

Gene ID

22163

UniProt

P47741

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPDIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human SAFB Protein - (Dry Ice)
H00006294-Q01-25ug 25 µg

Recombinant Human SAFB Protein - (Dry Ice)

Ask
View Details
Mouse MIP-1 alpha/CCL3 ELISA Kit
RK04218 96 Tests

Mouse MIP-1 alpha/CCL3 ELISA Kit

Ask
View Details
Recombinant Desulfobacterium autotrophicum Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1083975-01 0.02 mg (E-Coli)

Recombinant Desulfobacterium autotrophicum Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Ask
View Details
Recombinant Desulfobacterium autotrophicum Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1083975-02 0.02 mg (Yeast)

Recombinant Desulfobacterium autotrophicum Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Ask
View Details
Recombinant Desulfobacterium autotrophicum Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1083975-03 0.1 mg (E-Coli)

Recombinant Desulfobacterium autotrophicum Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Ask
View Details
Recombinant Desulfobacterium autotrophicum Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)
MBS1083975-04 0.1 mg (Yeast)

Recombinant Desulfobacterium autotrophicum Succinyl-CoA ligase [ADP-forming] subunit beta (sucC)

Ask
View Details