Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathepsin H/CTSH (C-6His)

Source: Human Cells. MW :36.1kD. Recombinant Mouse Cathepsin H is produced by our Mammalian expression system and the target gene encoding Glu22-Val333 is expressed with a 6His tag at the C-terminus. Cathepsin H (CTSH), which can act both as an aminopeptidase and as an endopeptidase, is a lysosomal cysteine protease of the papain family. CTSH is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. CTSH is associated with various pathological conditions like human fibrous meningioma, colorectal cancer, arthritis, human prostate tumor and lung cancer. CTSH is associated with cancer progression because of their ability to degrade extracellular matrices facilitating invasion, angiogenesis and metastasis as is evident from numerous clinical reports and experimental models. The expression of CTSH is significantly increased in disease states such as in prostate tumors, sera of asthmatic patients, and mucosa of colorectal cancer patients.

Product Specifications

Gene Name

Ctsh

Gene ID

13036

UniProt

Q3UCD6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQVVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpinactam
443820-01 250 µg

Calpinactam

Sign In for Pricing
View Details
Calpinactam
443820-02 500 µg

Calpinactam

Sign In for Pricing
View Details
Phospho-PRKCQ (Ser695) Polyclonal Antibody, PerCP Conjugated
bs-5584R-PerCP 100 µL

Phospho-PRKCQ (Ser695) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Putative zinc finger CCHC domain-containing protein 18 (ZCCHC18) Human ELISA Kit
G5789 96 Tests

Putative zinc finger CCHC domain-containing protein 18 (ZCCHC18) Human ELISA Kit

Sign In for Pricing
View Details
Synaptotagmin-9 Antibody
E55A14952 100 µg

Synaptotagmin-9 Antibody

Sign In for Pricing
View Details
Gamma-Endorphin (gEP) Mouse ELISA Kit
D6084 96 Tests

Gamma-Endorphin (gEP) Mouse ELISA Kit

Sign In for Pricing
View Details