Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathepsin H/CTSH (C-6His)

Source: Human Cells. MW :36.1kD. Recombinant Mouse Cathepsin H is produced by our Mammalian expression system and the target gene encoding Glu22-Val333 is expressed with a 6His tag at the C-terminus. Cathepsin H (CTSH), which can act both as an aminopeptidase and as an endopeptidase, is a lysosomal cysteine protease of the papain family. CTSH is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. CTSH is associated with various pathological conditions like human fibrous meningioma, colorectal cancer, arthritis, human prostate tumor and lung cancer. CTSH is associated with cancer progression because of their ability to degrade extracellular matrices facilitating invasion, angiogenesis and metastasis as is evident from numerous clinical reports and experimental models. The expression of CTSH is significantly increased in disease states such as in prostate tumors, sera of asthmatic patients, and mucosa of colorectal cancer patients.

Product Specifications

Gene Name

Ctsh

Gene ID

13036

UniProt

Q3UCD6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Srpx (NM_016911) Mouse Tagged ORF Clone
MR207414 10 µg

Srpx (NM_016911) Mouse Tagged ORF Clone

Ask
View Details
Mouse Dcc Antibody (C-term) Blocking Peptide
MBS9224128-01 0.5 mg

Mouse Dcc Antibody (C-term) Blocking Peptide

Ask
View Details
Mouse Dcc Antibody (C-term) Blocking Peptide
MBS9224128-02 5x 0.5 mg

Mouse Dcc Antibody (C-term) Blocking Peptide

Ask
View Details
Recombinant TRIM73 Antibody
RN-10998-01 50 μL

Recombinant TRIM73 Antibody

Ask
View Details
Recombinant TRIM73 Antibody
RN-10998-02 100 µL

Recombinant TRIM73 Antibody

Ask
View Details
Recombinant TRIM73 Antibody
RN-10998-03 1 mL

Recombinant TRIM73 Antibody

Ask
View Details