Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon gamma Receptor 1/IFN-gamma R1/CD119 (C-Fc)

Source: Human Cells. MW :53kD. Recombinant Mouse Interferon gamma Receptor 1 is produced by our Mammalian expression system and the target gene encoding Ala26-Asp253 is expressed with a Fc tag at the C-terminus. The tetrameric receptor complex for IFN gamma consists of two subunits, IFNGR1 (IFN gamma R alpha) and IFNGR2 (IFN gamma R beta), through which the dimeric IFN- gamma exerts its biological functions, including antiviral, antiproliferation and immune-modulatory activity in mammals. Both IFNGR1 and IFNGR2 are single transmembrane proteins belonging to the class II cytokine family. FNGR1, widely expressed in most host cells, is essential for IFN gamma binding, receptor trafficking, and signal transduction. IFNGR1 possesses an intracellular Janus tyrosine kinase (JAK) 1 binding site, a signal transducer and activator of transcription 1 (STAT1) binding site. The resulting STAT1 homodimers translocate from the cytoplasm to the nucleus and bind to the interferon-gamma activated sequence (GAS) promoter to induce expression of downstream interferon stimulated genes (ISGs) .

Product Specifications

Gene Name

Ifngr1

Gene ID

15979

UniProt

P15261

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLSTN2 Knockout A549 cell line
GTR15418487 1 Vial

Human CLSTN2 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Human RXRA Protein, Untagged, E.coli-10ug
QP13378-10ug 10ug

Recombinant Human RXRA Protein, Untagged, E.coli-10ug

Sign In for Pricing
View Details
Recombinant Human Proline, histidine and glycine-rich protein 1 (PHGR1)
MBS1150869-01 0.02 mg (E-Coli)

Recombinant Human Proline, histidine and glycine-rich protein 1 (PHGR1)

Sign In for Pricing
View Details
Recombinant Human Proline, histidine and glycine-rich protein 1 (PHGR1)
MBS1150869-02 0.1 mg (E-Coli)

Recombinant Human Proline, histidine and glycine-rich protein 1 (PHGR1)

Sign In for Pricing
View Details
Recombinant Human Proline, histidine and glycine-rich protein 1 (PHGR1)
MBS1150869-03 0.02 mg (Yeast)

Recombinant Human Proline, histidine and glycine-rich protein 1 (PHGR1)

Sign In for Pricing
View Details
Recombinant Human Proline, histidine and glycine-rich protein 1 (PHGR1)
MBS1150869-04 0.1 mg (Yeast)

Recombinant Human Proline, histidine and glycine-rich protein 1 (PHGR1)

Sign In for Pricing
View Details