Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon gamma Receptor 1/IFN-gamma R1/CD119 (C-6His)

Source: Human Cells. MW :26.9kD. Recombinant Mouse Interferon gamma Receptor 1 is produced by our Mammalian expression system and the target gene encoding Ala26-Asp253 is expressed with a 6His tag at the C-terminus. The tetrameric receptor complex for IFN gamma consists of two subunits, IFNGR1 (IFN gamma R alpha) and IFNGR2 (IFN gamma R beta), through which the dimeric IFN- gamma exerts its biological functions, including antiviral, antiproliferation and immune-modulatory activity in mammals. Both IFNGR1 and IFNGR2 are single transmembrane proteins belonging to the class II cytokine family. FNGR1, widely expressed in most host cells, is essential for IFN gamma binding, receptor trafficking, and signal transduction. IFNGR1 possesses an intracellular Janus tyrosine kinase (JAK) 1 binding site, a signal transducer and activator of transcription 1 (STAT1) binding site. The resulting STAT1 homodimers translocate from the cytoplasm to the nucleus and bind to the interferon-gamma activated sequence (GAS) promoter to induce expression of downstream interferon stimulated genes (ISGs) .

Product Specifications

Gene Name

Ifngr1

Gene ID

15979

UniProt

P15261

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human ZNF765 siRNA
abx941074-01 15 nmol

Human ZNF765 siRNA

Ask
View Details
Human ZNF765 siRNA
abx941074-02 30 nmol

Human ZNF765 siRNA

Ask
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Membrane-bound lytic murein transglycosylase C (mltC)
MBS1123132-01 0.02 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 5b Membrane-bound lytic murein transglycosylase C (mltC)

Ask
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Membrane-bound lytic murein transglycosylase C (mltC)
MBS1123132-02 0.02 mg (Yeast)

Recombinant Actinobacillus pleuropneumoniae serotype 5b Membrane-bound lytic murein transglycosylase C (mltC)

Ask
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Membrane-bound lytic murein transglycosylase C (mltC)
MBS1123132-03 0.1 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 5b Membrane-bound lytic murein transglycosylase C (mltC)

Ask
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 5b Membrane-bound lytic murein transglycosylase C (mltC)
MBS1123132-04 0.1 mg (Yeast)

Recombinant Actinobacillus pleuropneumoniae serotype 5b Membrane-bound lytic murein transglycosylase C (mltC)

Ask
View Details