Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming Growth Factor beta-2/TGF beta2/TGFB2

Source: Human Cells. MW :12.7kD. Recombinant Mouse Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed. Transforming growth factor beta 2 (TGF- beta2) is a member of TGF-beta superfamily that shares a characteristic cysteine knot structure. Mice with TGF- beta2 gene deletion show defects in development of cardiac, lung, craniofacial, limb, spinal column, eye, inner ear and urogenital systems. All TGF- beta isoforms signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I) . Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.

Product Specifications

Gene Name

Tgfb2

Gene ID

21808

UniProt

P27090

Components

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse 14,15-Epoxyeicosatrienoic Acid ELISA Kit
MBS7269853-01 48 Well

Mouse 14,15-Epoxyeicosatrienoic Acid ELISA Kit

Ask
View Details
Mouse 14,15-Epoxyeicosatrienoic Acid ELISA Kit
MBS7269853-02 96 Well

Mouse 14,15-Epoxyeicosatrienoic Acid ELISA Kit

Ask
View Details
Mouse 14,15-Epoxyeicosatrienoic Acid ELISA Kit
MBS7269853-03 5x 96 Well

Mouse 14,15-Epoxyeicosatrienoic Acid ELISA Kit

Ask
View Details
Mouse 14,15-Epoxyeicosatrienoic Acid ELISA Kit
MBS7269853-04 10x 96 Well

Mouse 14,15-Epoxyeicosatrienoic Acid ELISA Kit

Ask
View Details
RANGE 4 - Supplementary shelf for cabinet 113 L
ESP30 each

RANGE 4 - Supplementary shelf for cabinet 113 L

Ask
View Details
PCGF1 Rabbit Polyclonal Antibody (Center)
E28PB3079 100 µL

PCGF1 Rabbit Polyclonal Antibody (Center)

Ask
View Details