Recombinant Human IL-15 Receptor Subunit a/IL-15RA/CD215 (C-Fc)

Source: Human Cells. MW :45.5kD. Recombinant Human Interleukin-15 receptor alpha is produced by our Mammalian expression system and the target gene encoding Ile31-Thr205 is expressed with a Fc tag at the C-terminus. Interleukin 15 Receptor alpha (IL-15R alpha) is a transmembrane glycoprotein that plays a pleiotropic role in immune development and function, including the positive maintenance of lymphocyte homeostasis. IL-15R alpha chain can bind soluble IL-15 and â€œtranspresentâ€ cytokine to the cells, allowing them to respond to IL-15. Soluble IL-15R alpha can function as a specific high-affinity IL-15 antagonist. The soluble IL-15/IL-15R alpha complexes exhibit a strong agonistic activity which is mediated through membrane-bound IL-15 receptor beta and gamma heterodimers and enables signaling to cells.

Product Specifications

Gene Name

IL15RA

Gene ID

3601

UniProt

Q13261

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK