Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming Growth Factor beta-1/TGF beta1/TGFB1

Source: Human Cells. MW :12.8kD. Recombinant Mouse Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming growth factor beta 1 (TGF beta1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF- beta1, TGF- beta2 and TGF- beta3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I) . Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.

Product Specifications

Gene Name

Tgfb1

Gene ID

21803

UniProt

P04202

Components

Lyophilized from a 0.2 μm filtered solution of 50mM Glycine,150mM NaCl, pH 2.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH11 Antibody
42-598 0.1 mg

CDH11 Antibody

Sign In for Pricing
View Details
ZC3H12A Peptide - C-terminal region (AAP62562)
AAP62562-100UG 100 µg

ZC3H12A Peptide - C-terminal region (AAP62562)

Sign In for Pricing
View Details
Cleaved-Caspase-1 p20 (D210) Antibody
L0114-01 50 μL

Cleaved-Caspase-1 p20 (D210) Antibody

Sign In for Pricing
View Details
Cleaved-Caspase-1 p20 (D210) Antibody
L0114-02 100 µL

Cleaved-Caspase-1 p20 (D210) Antibody

Sign In for Pricing
View Details
Nomo1 Mouse shRNA Lentiviral Particle (Locus ID 211548)
TL506320V 500 µL Each

Nomo1 Mouse shRNA Lentiviral Particle (Locus ID 211548)

Sign In for Pricing
View Details
Kinesis 2/6 Man; P; SS
CHR2633 1 Each

Kinesis 2/6 Man; P; SS

Sign In for Pricing
View Details