Recombinant Mouse Transforming Growth Factor beta-1/TGF beta1/TGFB1
Source: Human Cells. MW :12.8kD. Recombinant Mouse Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming growth factor beta 1 (TGF beta1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF- beta1, TGF- beta2 and TGF- beta3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I) . Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.
Product Specifications
Gene Name
Tgfb1
Gene ID
21803
UniProt
P04202
Components
Lyophilized from a 0.2 μm filtered solution of 50mM Glycine,150mM NaCl, pH 2.5.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog