Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Carbonic Ahydrase 14/CA14 (N-6His)

Source: E.coli. MW :32.3kD. Recombinant Mouse Carbonic anhydrase 14 is produced by our E.coli expression system and the target gene encoding Ala16-Met290 is expressed with a 6His tag at the N-terminus. Mouse Ca14, also known as Carbonic anhydrase 14, is a member of large family of zinc metalloenzymes .It could catalyze reversible hydration of carbon dioxide. The reaction is fundamental to many processes such as respiration, renal tubular acidification and bone resorption. Fifteen CA isoforms have been reported so far. They have different patterns of tissue-specific expression and physiologic roles. Some CAs may serve as markers for tumors and hypoxia. CA XIV is a polypeptide consisting of an extracellular N-terminal catalytic domain, a membrane-spanning segment and a short intracellular C- terminal segment with several potential phosphorylation sites. A subset of CAs lack CA activity due to point mutations but retain esterase function. CA14 is widely expressed in the central nervous system

Product Specifications

Gene Name

Ca14

Gene ID

23831

UniProt

Q9WVT6

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Adnexa: right
CR559385 5 µg

Tissue Total RNA, Adnexa: right

Sign In for Pricing
View Details
Statherin (STATH) (NM_003154) Human Over-expression Lysate
LY418849 100 µg

Statherin (STATH) (NM_003154) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CTLA-4/CD152 protein (His tag)
PDMH100155-01 20 µg

Recombinant Human CTLA-4/CD152 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CTLA-4/CD152 protein (His tag)
PDMH100155-02 100 µg

Recombinant Human CTLA-4/CD152 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CTLA-4/CD152 protein (His tag)
PDMH100155-03 500 µg

Recombinant Human CTLA-4/CD152 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CTLA-4/CD152 protein (His tag)
PDMH100155-04 1 mg

Recombinant Human CTLA-4/CD152 protein (His tag)

Sign In for Pricing
View Details