Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-36b/IL-36b/IL1F8

Source: E.coli. MW :17.6kD. Recombinant Mouse Interleukin-36 beta is produced by our E.coli expression system and the target gene encoding Ser31-Lys183 is expressed. Mouse Interleukin 36 beta (IL-36B) is a member of the IL-1 family of proteins. It is a cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. IL-36B is synthesized in several cells including resting and activated monocytes, and B cells. The receptor for IL-36 beta is thought to be a combination of IL-1 Rrp2 and IL-1 RAcP. Interleukin 36 beta is one part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Interleukin 36 beta are involved in a number of fundamental biological processes such as stimulating production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes, inducing expression of a number of antimicrobial peptides including beta-defensin 4 and beta-defensin 103 as well as a number of matrix metalloproteases , inducing the production of proinflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23, and activating p38 MAPK phosphorylation in BMDCs.Moreover, interleukin 36 beta may be involved in skin inflammatory response by acting on keratinocytes, dendritic cells, and indirectly on T cells to drive tissue infiltration, cell maturation and cell proliferation. It plays an important role in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II and inducing the production of IFN-gamma, IL-4 and IL-17 by T helper 1 (Th1) cells, cultured CD4+ T cells and splenocytes.

Product Specifications

Gene Name

Il36b

Gene ID

69677

UniProt

Q9D6Z6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM Nacl,1mM EDTA, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CDK6 (NM_001259) Human Tagged ORF Clone Lentiviral Particle
RC208560L4V 200 µL

CDK6 (NM_001259) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Recombinant Mouse IL-4RA (C-6His)
PKSM041441-01 10 µg

Recombinant Mouse IL-4RA (C-6His)

Ask
View Details
Recombinant Mouse IL-4RA (C-6His)
PKSM041441-02 50 µg

Recombinant Mouse IL-4RA (C-6His)

Ask
View Details
Casein kinase 1δ-IN-8
HY-156666-01 5 mg

Casein kinase 1δ-IN-8

Ask
View Details
Casein kinase 1δ-IN-8
HY-156666-02 10 mg

Casein kinase 1δ-IN-8

Ask
View Details
PRAMEF7 Recombinant Protein Antigen
NBP2-46791PEP 100 µL

PRAMEF7 Recombinant Protein Antigen

Ask
View Details