Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hemoglobin Subunit theta-1/HBQ1 (N-6His)

Source: E.coli. MW :17.7kD. Recombinant Human Hemoglobin subunit theta-1 is produced by our E.coli expression system and the target gene encoding Met1-Arg142 is expressed with a 6His tag at the N-terminus. Hemoglobin subunit theta-1 is a protein that in humans is encoded by the HBQ1 gene. Theta-globin mRNA is originally found in human fetal erythroid tissue but not in adult erythroid or other nonerythroid tissue. Theta-1 is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. Research supports a transcriptionally active role for the gene and a functional role for the peptide in specific cells, possibly those of early erythroid tissue. Hemoglobin has a quaternary structure characteristically composed of many multi-subunit globular proteins. Most of the amino acids in hemoglobin form alpha helices, connected by short non-helical segments. Hydrogen bonds stabilize the helical sections inside this protein, causing attractions within the molecule, folding each polypeptide chain into a specific shape. Hemoglobin's quaternary structure comes from its four subunits in roughly a tetrahedral arrangement.

Product Specifications

Gene Name

HBQ1

Gene ID

3049

UniProt

P09105

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Interferon-induced GTP-binding protein Mx2 (MX2) Rat ELISA Kit
E3470 96 Tests

Interferon-induced GTP-binding protein Mx2 (MX2) Rat ELISA Kit

Ask
View Details
Human COBL siRNA
abx901171-01 15 nmol

Human COBL siRNA

Ask
View Details
Human COBL siRNA
abx901171-02 30 nmol

Human COBL siRNA

Ask
View Details
Mono-O-ethyl Disalicylimide
456475-01 10 mg

Mono-O-ethyl Disalicylimide

Ask
View Details
Mono-O-ethyl Disalicylimide
456475-02 25 mg

Mono-O-ethyl Disalicylimide

Ask
View Details
MMP13 (C-Term) Rabbit pAb
MBS8558207-01 0.1 mL

MMP13 (C-Term) Rabbit pAb

Ask
View Details